Peptide Medix product catalog

Peptide Medix

VIP (Vasoactive Intestinal Peptide)

Vasoactive intestinal peptide, a 28-residue amidated neuropeptide

Review catalog details Secure payments
Available to order · 2 of 2 options available
$97.00 $115.00 15% OFF

Choose an option

1
Categories: vip , vasoactive intestinal peptide , neuropeptide

Choose your delivery method

Standard Shipping is automatically selected at checkout. Customers can upgrade to a faster delivery option anytime.

Overview

Vasoactive intestinal peptide is a twenty-eight residue neuropeptide first isolated from porcine intestine and later shown to be widely distributed through the central and peripheral nervous systems, the gastrointestinal tract, the lungs and immune tissue. It belongs to the secretin-glucagon superfamily, sharing structural features with PACAP, secretin and glucagon, and is amidated at its C-terminus, a modification required for full receptor engagement.

Its signalling runs primarily through two G protein-coupled receptors, VPAC1 and VPAC2, both of which raise intracellular cyclic AMP. The breadth of receptor distribution explains why VIP appears in such varied literatures — smooth muscle relaxation and vasodilation, circadian regulation in the suprachiasmatic nucleus, airway and gut physiology, and immune cell modulation all draw on the same molecule.

The peptide supplied here is made by solid-phase synthesis, purified by reversed-phase HPLC to at least 99% and filled as a lyophilized powder into sealed 5 mg and 10 mg glass vials, each with a lot-matched certificate of analysis. Because of its length and its C-terminal amide, it is a comparatively demanding synthesis. Sold for laboratory research only.

Specifications

Brand Peptide Medix
Category Anti-Inflammatory Peptides
Form Lyophilized powder, sealed glass vial with crimped stopper
Purity ≥99% by HPLC; lot-matched COA available
Available sizes 5 mg, 10 mg
CAS number 37221-79-7
Molecular weight 3326.80 g/mol
Amino acid sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Chain length 28 amino acids, C-terminally amidated
Peptide class Neuropeptide of the secretin-glucagon (VIP/PACAP) superfamily
Receptors VPAC1 and VPAC2 G protein-coupled receptors; signals via cyclic AMP
Native distribution Central and enteric nervous systems, lung, gut, immune tissue
Research areas Vasodilation and smooth muscle, airway physiology, circadian biology, immune modulation
Storage (lyophilized) −20 °C, sealed and protected from light and moisture
Storage (reconstituted) 2–8 °C, protected from light, used within the study window
SKU VIP-5-MG

Highlights

  • ≥99% purity by HPLC with mass confirmation; lot-matched COA available on request
  • Supplied in 5 mg and 10 mg lyophilized vials, sealed with a crimped stopper
  • Twenty-eight residue neuropeptide of the secretin-glucagon superfamily
  • C-terminally amidated, the modification associated with full receptor activity
  • Signals through the VPAC1 and VPAC2 G protein-coupled receptors via cyclic AMP
  • Studied in smooth muscle, airway, circadian, gastrointestinal and immune models
  • Held in United States stock, shipped with insulated and discreet packaging

What's Included

  • The vial option and size selected above
  • Final item and quantity confirmed in cart
  • Laboratory-research-use labeling

Research Overview

Discovery and family

VIP was isolated from porcine duodenum in the early 1970s during a search for vasodilatory factors in gut extracts, which is where its name comes from. It was later recognised as a neuropeptide rather than a purely gut hormone, and as a member of the secretin-glucagon superfamily alongside PACAP, with which it shares receptor overlap. The C-terminal amide is a post-translational feature reproduced in synthetic material.

Receptor pharmacology

Binding at VPAC1 and VPAC2 activates adenylate cyclase and raises intracellular cyclic AMP, with downstream protein kinase A signalling. Receptor distribution differs by tissue, and much of the pharmacological literature concerns selective analogues designed to separate VPAC1 from VPAC2 effects, since the native peptide engages both.

Physiological research areas

Reported activities in animal and tissue preparations include relaxation of vascular and non-vascular smooth muscle, effects on airway calibre and mucus secretion, regulation of intestinal motility and secretion, and a well-characterised role in the suprachiasmatic nucleus where VIP signalling is central to synchronising the circadian clock across neuron populations.

Immunological work

A substantial literature describes VIP as an endogenous modulator of inflammatory responses, with reported effects on macrophage cytokine output, T helper cell balance and regulatory T cell populations in rodent models of autoimmunity. This has driven interest in VPAC-targeted compounds, none of which has become an established therapy.

Stability and evidence scope

Native VIP has a short circulating half-life owing to peptidase cleavage, and much analogue development has aimed at extending it. Nothing described here constitutes a claim about effects in people; this vial is a laboratory reagent supplied without protocol or dosing guidance.

Handling & Storage

Store the sealed vial at −20 °C, dry and protected from light, and bring it to room temperature before opening so condensation does not settle on the cake. Reconstitute with sterile or bacteriostatic water introduced slowly against the inner vial wall, swirling gently until clear; do not vortex, since a twenty-eight residue amidated peptide foams and aggregates easily. VIP is peptidase-sensitive, so laboratories generally prepare working dilutions fresh, keep stock solutions at 2–8 °C protected from light and aliquot before freezing rather than thawing a single tube repeatedly.

VIP (Vasoactive Intestinal Peptide) FAQ

What is VIP?
VIP is vasoactive intestinal peptide, a twenty-eight amino acid neuropeptide of the secretin-glucagon superfamily. Originally isolated from intestine, it is expressed throughout the nervous system, lung, gut and immune tissue, and signals through the VPAC1 and VPAC2 receptors.
Why does the sequence end in NH2?
The native peptide is amidated at its C-terminus, a post-translational modification that the published pharmacology associates with full receptor binding and activity. Synthetic material intended for research reproduces that amide rather than leaving a free carboxyl terminus.
What receptors does VIP act on?
Principally VPAC1 and VPAC2, two closely related G protein-coupled receptors that activate adenylate cyclase and raise intracellular cyclic AMP. Because native VIP engages both, much pharmacological work uses selective analogues to separate the contributions of each receptor subtype.
What purity is supplied and is a COA available?
Each lot is purified and analysed by reversed-phase HPLC to at least 99% with mass confirmation against the expected mass of 3326.80 g/mol. A certificate of analysis matched to the lot number on your vial label is available on request before or after purchase.
How stable is reconstituted VIP?
Less stable than short, rigid peptides. It is peptidase-sensitive and, like most longer amidated sequences, prone to aggregation and surface adsorption. Laboratories generally aliquot immediately after reconstitution, keep stocks cold and protected from light, and prepare working dilutions fresh on the day.

This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

Customer Reviews

0 reviews
5 star
0%
4 star
0%
3 star
0%
2 star
0%
1 star
0%

Leave Your Review

Rating

No reviews yet — be the first!

Leave Your Review

Rating

Keep exploring

Related Products & Shopping Guides

Compare VIP (Vasoactive Intestinal Peptide) with relevant categories, product topics, and practical shopping information.

Often researched together

Related research peptides, blends and lab supplies frequently ordered with VIP (Vasoactive Intestinal Peptide).

15% OFF
LL-37 (Cathelicidin)

Peptide Medix

LL-37 (Cathelicidin)

ll-37

2 options

$97.00 $115.00

View options and product details

15% OFF
KPV

Peptide Medix

KPV

kpv

2 options

$42.00 $50.00

View options and product details

15% OFF
Larazotide Acetate

Peptide Medix

Larazotide Acetate

larazotide

2 options

$72.00 $85.00

View options and product details

15% OFF
ARA-290 (Cibinetide)

Peptide Medix

ARA-290 (Cibinetide)

ara-290

2 options

$85.00 $100.00

View options and product details

15% OFF
GHK-Cu (Copper Peptide)

Peptide Medix

GHK-Cu (Copper Peptide)

ghk-cu

5 options

$25.00 $30.00

View options and product details

15% OFF
BPC-157

Peptide Medix

BPC-157

bpc-157

7 options

$34.00 $40.00

View options and product details