Peptide Medix product catalog

Peptide Medix

LL-37 (Cathelicidin)

Human cathelicidin LL-37, a 37-residue antimicrobial host-defence peptide

Review catalog details Secure payments
Available to order · 2 of 2 options available
$97.00 $115.00 15% OFF

Choose an option

1
Categories: ll-37 , cathelicidin , antimicrobial peptide

Choose your delivery method

Standard Shipping is automatically selected at checkout. Customers can upgrade to a faster delivery option anytime.

Overview

LL-37 is the only cathelicidin-family antimicrobial peptide found in humans. It is released from the C-terminus of the precursor protein hCAP18 by proteinase 3 cleavage and takes its name from its length and its two leading leucine residues. Neutrophils, epithelial cells and keratinocytes all express it, and it sits at the interface between innate antimicrobial defence and the regulation of inflammation.

Structurally it is a cationic, amphipathic alpha helix of thirty-seven residues carrying a strong net positive charge. That geometry is central to the mechanism most often described in the literature: electrostatic association with anionic bacterial membranes followed by disruption of membrane integrity. The same amphipathic character makes it a demanding peptide to synthesise and purify, which is reflected in its price relative to shorter sequences.

Supplied as a lyophilized powder in sealed 5 mg and 10 mg vials, each lot is purified by reversed-phase HPLC to at least 99% with mass confirmation and a lot-matched certificate of analysis. Laboratories study it in antimicrobial assays, biofilm work, wound models and immunomodulation research. It is sold strictly for laboratory research use.

Specifications

Brand Peptide Medix
Category Anti-Inflammatory Peptides
Form Lyophilized powder, sealed glass vial with crimped stopper
Purity ≥99% by HPLC; lot-matched COA available
Available sizes 5 mg, 10 mg
CAS number 154947-66-7
Molecular weight 4493.33 g/mol
Amino acid sequence [LL-37, 37 aa]
Chain length 37 amino acids
Peptide class Cathelicidin-family antimicrobial host-defence peptide
Precursor hCAP18; released by proteinase 3 cleavage of the C-terminal domain
Structure Cationic amphipathic alpha helix with a strong net positive charge
Research areas Antimicrobial and antibiofilm assays, wound repair, immunomodulation, barrier immunity
Storage (lyophilized) −20 °C, sealed and protected from light and moisture
Storage (reconstituted) 2–8 °C, protected from light, used within the study window
SKU LL-37-5-MG

Highlights

  • ≥99% purity by HPLC with mass confirmation; lot-matched COA available on request
  • Two vial sizes — 5 mg and 10 mg — of lyophilized, sealed research-grade powder
  • Thirty-seven residue cationic, amphipathic alpha-helical host-defence peptide
  • The sole human cathelicidin, released from the hCAP18 precursor protein
  • Studied in antimicrobial, antibiofilm, wound-repair and immunomodulation models
  • Demanding synthesis and purification, reflected in a higher price per milligram
  • Stocked in the United States and dispatched in insulated, discreet packaging

What's Included

  • The vial option and size selected above
  • Final item and quantity confirmed in cart
  • Laboratory-research-use labeling

Research Overview

Biology of the human cathelicidin

Cathelicidins are a conserved family of host-defence peptides, and humans express exactly one: the hCAP18 precursor, whose C-terminal domain is cleaved to release LL-37. Expression is documented in neutrophil granules, skin keratinocytes, airway epithelium and the gastrointestinal lining, and several papers link expression levels to vitamin D receptor signalling, a connection studied extensively in barrier immunity.

Membrane-directed antimicrobial work

The classical in-vitro literature examines activity against Gram-positive and Gram-negative bacteria, fungi and enveloped viruses. The proposed mechanism is electrostatic attraction of the cationic helix to anionic membrane surfaces followed by insertion and permeabilisation. Because that mechanism is physical rather than target-specific, papers frequently note that resistance develops less readily than with conventional antibiotics, though activity is markedly reduced at physiological salt concentrations.

Biofilm and wound models

Immunomodulatory research

LL-37 also binds bacterial lipopolysaccharide and nucleic acids, and papers describe modulation of dendritic cell and monocyte responses. This is a double-edged literature: the same complex-forming behaviour has been implicated in autoimmune conditions such as psoriasis, which is why the peptide is studied as a driver of inflammation as well as a defence against infection.

Handling considerations and scope

Its amphipathic character makes it prone to adsorption on plastic and to aggregation, so laboratories often use low-binding tubes and carrier proteins in dilute assays. All statements above summarise published research; the peptide is supplied as a laboratory reagent only.

LL-37 (Cathelicidin) FAQ

What is LL-37?
LL-37 is the only cathelicidin antimicrobial peptide expressed in humans, a thirty-seven residue cationic helix released from the hCAP18 precursor protein. It is supplied here as a lyophilized research powder for antimicrobial, biofilm, wound-repair and immunomodulation studies.
Why is LL-37 more expensive than shorter peptides?
At thirty-seven residues it is long by synthesis standards, and its amphipathic, highly cationic character makes both the coupling steps and the purification harder than for a short hydrophilic sequence. Yield per synthesis run is lower, and that cost is reflected in the price per milligram.
What purity do you supply and is a COA available?
Every lot is purified and analysed by reversed-phase HPLC to at least 99% with mass-spectrometric confirmation against the expected 4493.33 g/mol mass. A certificate of analysis matched to the lot number on your vial is available on request before or after ordering.
Does LL-37 need special handling?
It benefits from it. The peptide adsorbs to plastic and aggregates more readily than short hydrophilic sequences, so laboratories generally use low-binding tubes, avoid vortexing and prepare working dilutions fresh rather than storing very dilute stocks for long periods.
What research areas does LL-37 appear in?
Membrane-directed antimicrobial assays against bacteria, fungi and enveloped viruses; biofilm interference at sub-lethal concentrations; wound-repair models involving keratinocyte migration; and immunomodulation work covering lipopolysaccharide binding and dendritic cell responses, including its implicated role in psoriasis.
Can LL-37 be used outside a laboratory?
No. This vial is a research chemical supplied for in-vitro and laboratory investigation by qualified personnel. It is not a drug, supplement or medical product, has no approval for human or veterinary administration, and ships without any dosing or protocol guidance.

This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

Customer Reviews

0 reviews
5 star
0%
4 star
0%
3 star
0%
2 star
0%
1 star
0%

Leave Your Review

Rating

No reviews yet — be the first!

Leave Your Review

Rating

Keep exploring

Related Products & Shopping Guides

Compare LL-37 (Cathelicidin) with relevant categories, product topics, and practical shopping information.

Often researched together

Related research peptides, blends and lab supplies frequently ordered with LL-37 (Cathelicidin).

15% OFF
Thymosin Alpha-1

Peptide Medix

Thymosin Alpha-1

thymosin alpha-1

3 options

$72.00 $85.00

View options and product details

15% OFF
KPV

Peptide Medix

KPV

kpv

2 options

$42.00 $50.00

View options and product details

15% OFF
Thymalin

Peptide Medix

Thymalin

thymalin

2 options

$46.00 $55.00

View options and product details

15% OFF
ARA-290 (Cibinetide)

Peptide Medix

ARA-290 (Cibinetide)

ara-290

2 options

$85.00 $100.00

View options and product details

15% OFF
GHK-Cu (Copper Peptide)

Peptide Medix

GHK-Cu (Copper Peptide)

ghk-cu

5 options

$25.00 $30.00

View options and product details