Research Peptides · Cat. RP10335
PACAP (1-38), human, ovine, rat
Supplied as 0.5 mg per unit. Purity > 95%. Molecular weight 4534.26. Species: Human, Rat, Ovine. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP10335 |
|---|---|
| Product type | Research Peptides |
| Peptide family | PACAP (Pituitary Adenylate Cyclase-Activating Polypeptide) |
| Species | Human, Rat, Ovine |
| Unit size | 0.5 mg |
| Molecular weight | 4534.26 Da |
| Purity | > 95% |
| Appearance | Lyophilized |
| Note | PACAP stimulates adenylate cyclase in rat anterior pituitary cells. |
| Cas No | 137061-48-4 |
| C Terminal | Amidation |
| Molecular Formula | C203H331N63O53S1 |
| Source categories | Cell Signaling |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
Storage & handling
Store the peptide at -20°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is PACAP (1-38), human, ovine, rat?
PACAP (1-38), human, ovine, rat is a research peptide listed under catalog number RP10335 in the PACAP (Pituitary Adenylate Cyclase-Activating Polypeptide) family, human / rat / ovine sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP10335?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should PACAP (1-38), human, ovine, rat be stored?
Store the peptide at -20°C.
What is the intended use of RP10335?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.