Peptide Medix product catalog

Research Peptides · Cat. RP20332

LL-37, scrambled

Supplied as 1 mg per unit. Purity >95%. Molecular weight 4493.3. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog numberRP20332
Product typeResearch Peptides
Peptide familyLL-37 / Human Cathelicidin
SpeciesOther species
Unit size1 mg
Molecular weight4493.3 Da
Purity>95%
AppearanceLyophilized
Molecular FormulaC205H340N60O53
Source categoriesCancer, Cell Signaling
Research topicsCancer Research
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Storage & handling

Store at -20°C.

Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.

Frequently asked

What is LL-37, scrambled?
LL-37, scrambled is a research peptide listed under catalog number RP20332 in the LL-37 / Human Cathelicidin family, other species sequence. It is supplied as 1 mg per unit for in vitro laboratory research.
What purity is listed for RP20332?
The imported catalog record lists >95%. Request and verify current lot-specific documentation before purchase.
How should LL-37, scrambled be stored?
Store at -20°C.
What is the intended use of RP20332?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.