Research Peptides · Cat. RP20332
LL-37, scrambled
Supplied as 1 mg per unit. Purity >95%. Molecular weight 4493.3. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP20332 |
|---|---|
| Product type | Research Peptides |
| Peptide family | LL-37 / Human Cathelicidin |
| Species | Other species |
| Unit size | 1 mg |
| Molecular weight | 4493.3 Da |
| Purity | >95% |
| Appearance | Lyophilized |
| Molecular Formula | C205H340N60O53 |
| Source categories | Cancer, Cell Signaling |
| Research topics | Cancer Research |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Storage & handling
Store at -20°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is LL-37, scrambled?
LL-37, scrambled is a research peptide listed under catalog number RP20332 in the LL-37 / Human Cathelicidin family, other species sequence. It is supplied as 1 mg per unit for in vitro laboratory research.
What purity is listed for RP20332?
The imported catalog record lists >95%. Request and verify current lot-specific documentation before purchase.
How should LL-37, scrambled be stored?
Store at -20°C.
What is the intended use of RP20332?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.