Peptide Libraries · Cat. RP30254
HRSVA (Fusion Glycoprotein F0)
Supplied as 1 vial(25μg/peptide) per unit. Purity >90%. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP30254 |
|---|---|
| Product type | Peptide Libraries |
| Peptide family | Peptide Libraries |
| Species | Other species |
| Unit size | 1 vial(25μg/peptide) |
| Purity | >90% |
| Appearance | Lyophilized |
| Source categories | Peptide Library |
| Research topics | Peptide Libraries & Pools |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Storage & handling
Store at -20°C. Keep tightly closed. Store in a cool dry place.
Frequently asked
What is HRSVA (Fusion Glycoprotein F0)?
What purity is listed for RP30254?
How should HRSVA (Fusion Glycoprotein F0) be stored?
What is the intended use of RP30254?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.