Peptide Medix product catalog

Peptide Libraries · Cat. RP30254

HRSVA (Fusion Glycoprotein F0)

Supplied as 1 vial(25μg/peptide) per unit. Purity >90%. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog numberRP30254
Product typePeptide Libraries
Peptide familyPeptide Libraries
SpeciesOther species
Unit size1 vial(25μg/peptide)
Purity>90%
AppearanceLyophilized
Source categoriesPeptide Library
Research topicsPeptide Libraries & Pools
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN

Storage & handling

Store at -20°C. Keep tightly closed. Store in a cool dry place.

Frequently asked

What is HRSVA (Fusion Glycoprotein F0)?
HRSVA (Fusion Glycoprotein F0) is a peptide librarie listed under catalog number RP30254 in the Peptide Libraries family, other species sequence. It is supplied as 1 vial(25μg/peptide) per unit for in vitro laboratory research.
What purity is listed for RP30254?
The imported catalog record lists >90%. Request and verify current lot-specific documentation before purchase.
How should HRSVA (Fusion Glycoprotein F0) be stored?
Store at -20°C. Keep tightly closed. Store in a cool dry place.
What is the intended use of RP30254?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.