Research Peptides · Cat. RP30247
[Gly22]-β-Amyloid (1-42), Arctic Mutation
Supplied as 0.5 mg per unit. Purity >95%. Molecular weight 4442.00. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP30247 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Amyloid-Beta (Abeta) & Amyloid Precursor Protein |
| Species | Other species |
| Unit size | 0.5 mg |
| Molecular weight | 4442.00 Da |
| Purity | >95% |
| Appearance | Lyophilized |
| Available sizes | 0.5 mg — US$125; 1 mg — US$215 |
| Source categories | Neuroscience |
| Research topics | Neuropeptides & Neuroscience, Alzheimer's & Neurodegeneration |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Storage & handling
Store at -20°C. Keep tightly closed. Store in a cool dry place.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is [Gly22]-β-Amyloid (1-42), Arctic Mutation?
What purity is listed for RP30247?
How should [Gly22]-β-Amyloid (1-42), Arctic Mutation be stored?
What is the intended use of RP30247?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.