Peptide Medix product catalog

Research Peptides · Cat. RP30250

[Gly22]-β-Amyloid (1-40), Arctic Mutation

Supplied as 0.5 mg per unit. Purity >95%. Molecular weight 4257.76. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog numberRP30250
Product typeResearch Peptides
Peptide familyAmyloid-Beta (Abeta) & Amyloid Precursor Protein
SpeciesOther species
Unit size0.5 mg
Molecular weight4257.76 Da
Purity>95%
AppearanceLyophilized
Available sizes0.5 mg — US$115; 1 mg — US$195
Source categoriesNeuroscience
Research topicsNeuropeptides & Neuroscience, Alzheimer's & Neurodegeneration
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV

Storage & handling

Store at -20°C. Keep tightly closed. Store in a cool dry place.

Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.

Frequently asked

What is [Gly22]-β-Amyloid (1-40), Arctic Mutation?
[Gly22]-β-Amyloid (1-40), Arctic Mutation is a research peptide listed under catalog number RP30250 in the Amyloid-Beta (Abeta) & Amyloid Precursor Protein family, other species sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP30250?
The imported catalog record lists >95%. Request and verify current lot-specific documentation before purchase.
How should [Gly22]-β-Amyloid (1-40), Arctic Mutation be stored?
Store at -20°C. Keep tightly closed. Store in a cool dry place.
What is the intended use of RP30250?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.