Research Peptides · Cat. RP10795
Gastric Inhibitory Peptide (GIP), human
Supplied as 0.5 mg per unit. Purity > 95%. Molecular weight 4983.6. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP10795 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Glucose-Dependent Insulinotropic Polypeptide (GIP) |
| Species | Human |
| Unit size | 0.5 mg |
| Molecular weight | 4983.6 Da |
| Purity | > 95% |
| Appearance | Lyophilized |
| Cas No | 100040-31-1 |
| Molecular Formula | C226H338N60O66S1 |
| Source categories | Diabetes & Obesity, Top Pick |
| Research topics | Diabetes & Metabolism, Obesity & Appetite |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Storage & handling
Store the peptide at -20°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Gastric Inhibitory Peptide (GIP), human?
Gastric Inhibitory Peptide (GIP), human is a research peptide listed under catalog number RP10795 in the Glucose-Dependent Insulinotropic Polypeptide (GIP) family, human sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP10795?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should Gastric Inhibitory Peptide (GIP), human be stored?
Store the peptide at -20°C.
What is the intended use of RP10795?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.