Research Peptides · Cat. RP11344
β-Endorphin, human
Supplied as 1 mg per unit. Purity > 95%. Molecular weight 3465.1. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP11344 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Endorphins (beta-Endorphin) |
| Species | Human |
| Unit size | 1 mg |
| Molecular weight | 3465.1 Da |
| Purity | > 95% |
| Appearance | Lyophilized |
| Cas No | 61214-51-5 |
| Molecular Formula | C158H251N39O46S1 |
| Source categories | Cell Signaling, Neuroscience |
| Research topics | Neuropeptides & Neuroscience |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Storage & handling
Store the peptide at -20°C
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is β-Endorphin, human?
β-Endorphin, human is a research peptide listed under catalog number RP11344 in the Endorphins (beta-Endorphin) family, human sequence. It is supplied as 1 mg per unit for in vitro laboratory research.
What purity is listed for RP11344?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should β-Endorphin, human be stored?
Store the peptide at -20°C
What is the intended use of RP11344?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.