Research Peptides · Cat. 067-45
Apolipopprotein A-IV ( 55-121) / T55-121 (Mouse)
Supplied as 100ug per unit. Purity ≥ 95%. Molecular weight 7635.72. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 067-45 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Other Research Peptides |
| Unit size | 100ug |
| Molecular weight | 7635.72 Da |
| Purity | ≥ 95% |
| Validation | Exhibits correct molecular weight |
| Contents | Each vial contains 100 µg of NET peptide. |
| Solubility | Soluble in water |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
TQQLSTLFQDKLGDASTYADGVHNKLVPFVVQLSGHLAQETERVKE EIKKELEDLRDRMMPHANKVT
Storage & handling
Store in dry form at 0-5°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Apolipopprotein A-IV ( 55-121) / T55-121 (Mouse)?
What purity is listed for 067-45?
How should Apolipopprotein A-IV ( 55-121) / T55-121 (Mouse) be stored?
What is the intended use of 067-45?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.