Research Peptides · Cat. 067-47
Apolipopprotein A-IV ( 122-153) (Human) / T55-121 (Mouse)
Supplied as 100 ug per unit. Purity ≥ 95%. Molecular weight 3753.17. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 067-47 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Other Research Peptides |
| Unit size | 100 ug |
| Molecular weight | 3753.17 Da |
| Purity | ≥ 95% |
| Validation | Exhibits correct molecular weight |
| Appearance | White powder |
| Contents | Each vial contains 100 µg of NET peptide |
| Solubility | Soluble in water |
| Research topics | Diabetes & Metabolism |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
pGlu-KIGDNLRELQQRLEPYADQLRTQVSTQAEQL
Storage & handling
Store in dry form at 0-5°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Apolipopprotein A-IV ( 122-153) (Human) / T55-121 (Mouse)?
Apolipopprotein A-IV ( 122-153) (Human) / T55-121 (Mouse) is a research peptide listed under catalog number 067-47 in the Other Research Peptides family. It is supplied as 100 ug per unit for in vitro laboratory research.
What purity is listed for 067-47?
The imported catalog record lists ≥ 95% (exhibits correct molecular weight). Request and verify current lot-specific documentation before purchase.
How should Apolipopprotein A-IV ( 122-153) (Human) / T55-121 (Mouse) be stored?
Store in dry form at 0-5°C.
What is the sequence of Apolipopprotein A-IV ( 122-153) (Human) / T55-121 (Mouse)?
The 1-residue sequence is pGlu-KIGDNLRELQQRLEPYADQLRTQVSTQAEQL, molecular weight 3753.17.
What is the intended use of 067-47?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.