Labeled Peptides · Biotin-labeled · Cat. B-032-35
Adropin (34-76) (Human, Rat, Mouse) – Biotin Labeled
Supplied as 20 µg per unit. Species: Human, Mouse, Rat. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | B-032-35 |
|---|---|
| Product type | Labeled Peptides · Biotin-labeled |
| Peptide family | Adropin |
| Species | Human, Mouse, Rat |
| Unit size | 20 µg |
| Validation | Exhibits correct molecular weight |
| Contents | Each vial contains 20 µg of NET labeled peptide. |
| Disulfide Bridge | Disulfide bridge(s): Cys34-Cys56 |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Frequently asked
What is Adropin (34-76) (Human, Rat, Mouse) – Biotin Labeled?
What is the intended use of B-032-35?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.