Research Peptides · Cat. RP30886
Tau peptide (337-368) (Repeat4 domain)
Supplied as 1 mg per unit. Purity >95%. Molecular weight 3467.89. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP30886 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Tau Protein (MAPT) |
| Species | Other species |
| Unit size | 1 mg |
| Molecular weight | 3467.89 Da |
| Purity | >95% |
| Appearance | Lyophilized |
| Length | 32 |
| Synonyms | Tau peptide (337-368) (Repeat4 domain) |
| Molecular Formula | C₁₅₀H₂₄₈N₄₄O₅₀ |
| Source categories | Neuroscience |
| Research topics | Neuropeptides & Neuroscience, Alzheimer's & Neurodegeneration |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Storage & handling
Store at -20°C. Keep tightly closed. Store in a cool dry place.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Tau peptide (337-368) (Repeat4 domain)?
What purity is listed for RP30886?
How should Tau peptide (337-368) (Repeat4 domain) be stored?
What is the intended use of RP30886?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.