Research Peptides · Cat. RP30889
Tau peptide (306-336) (Repeat3 domain)
Supplied as 1 mg per unit. Purity >95%. Molecular weight 3247.77. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP30889 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Tau Protein (MAPT) |
| Species | Other species |
| Unit size | 1 mg |
| Molecular weight | 3247.77 Da |
| Purity | >95% |
| Appearance | Lyophilized |
| Length | 31 |
| Synonyms | Tau peptide (306-336) (Repeat3 domain) |
| Molecular Formula | C₁₄₃H₂₃₆N₄₂O₄₂S |
| Source categories | Neuroscience |
| Research topics | Neuropeptides & Neuroscience, Alzheimer's & Neurodegeneration |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Storage & handling
Store at -20°C. Keep tightly closed. Store in a cool dry place.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Tau peptide (306-336) (Repeat3 domain)?
Tau peptide (306-336) (Repeat3 domain) is a research peptide listed under catalog number RP30889 in the Tau Protein (MAPT) family, other species sequence. It is supplied as 1 mg per unit for in vitro laboratory research.
What purity is listed for RP30889?
The imported catalog record lists >95%. Request and verify current lot-specific documentation before purchase.
How should Tau peptide (306-336) (Repeat3 domain) be stored?
Store at -20°C. Keep tightly closed. Store in a cool dry place.
What is the intended use of RP30889?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.