Research Peptides · Cat. 049-85
Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat)
Supplied as 100µg per unit. Purity ≥ 94%. Molecular weight 8137.47. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 049-85 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Other Research Peptides |
| Species | Human |
| Unit size | 100µg |
| Molecular weight | 8137.47 Da |
| Purity | ≥ 94% |
| Validation | Exhibits correct molecular weight |
| Appearance | White powder |
| Contents | Each vial contains 100 μg of NET peptide. |
| Solubility | Dissolve peptide with small amount of 50% Acetonitrile |
| Disulfide Bridge | Disulfide Bridge: Cys1-Cys2 |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
DLQCWNTCSLTLIDLKEIKIEHNVDAFWNFMLFLQKSQRPGHYSVFLNIAQDFWDMYIDCLLSRSHGM-NH2
Storage & handling
Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat)?
What purity is listed for 049-85?
How should Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat) be stored?
What is the sequence of Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat)?
What is the intended use of 049-85?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.