Peptide Medix product catalog

Research Peptides · Cat. 049-85

Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat)

Supplied as 100µg per unit. Purity ≥ 94%. Molecular weight 8137.47. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog number049-85
Product typeResearch Peptides
Peptide familyOther Research Peptides
SpeciesHuman
Unit size100µg
Molecular weight8137.47 Da
Purity≥ 94%
ValidationExhibits correct molecular weight
AppearanceWhite powder
ContentsEach vial contains 100 μg of NET peptide.
SolubilityDissolve peptide with small amount of 50% Acetonitrile
Disulfide BridgeDisulfide Bridge: Cys1-Cys2
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

DLQCWNTCSLTLIDLKEIKIEHNVDAFWNFMLFLQKSQRPGHYSVFLNIAQDFWDMYIDCLLSRSHGM-NH2

1 residues · MW 8137.47 · C-terminal amide

Storage & handling

Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.

Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.

Frequently asked

What is Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat)?
Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat) is a research peptide listed under catalog number 049-85 in the Other Research Peptides family, human sequence. It is supplied as 100µg per unit for in vitro laboratory research.
What purity is listed for 049-85?
The imported catalog record lists ≥ 94% (exhibits correct molecular weight). Request and verify current lot-specific documentation before purchase.
How should Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat) be stored?
Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
What is the sequence of Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat)?
The 1-residue sequence is DLQCWNTCSLTLIDLKEIKIEHNVDAFWNFMLFLQKSQRPGHYSVFLNIAQDFWDMYIDCLLSRSHGM-NH2, molecular weight 8137.47.
What is the intended use of 049-85?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.