Research Peptides · Cat. RP10492
Neuropeptide Y, human
Supplied as 0.5 mg per unit. Purity > 95%. Molecular weight 4271.68. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP10492 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Neuropeptide Y (NPY) |
| Species | Human |
| Unit size | 0.5 mg |
| Molecular weight | 4271.68 Da |
| Purity | > 95% |
| Appearance | Lyophilized |
| Cas No | 90880-35-6 |
| Synonyms | NPY |
| C Terminal | Amidation |
| Molecular Formula | C189H285N55O57S1 |
| Source categories | Cardiovascular, Cell Signaling, Neuroscience |
| Research topics | Cardiovascular Research, Neuropeptides & Neuroscience |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Storage & handling
Store at -20°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Neuropeptide Y, human?
Neuropeptide Y, human is a research peptide listed under catalog number RP10492 in the Neuropeptide Y (NPY) family, human sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP10492?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should Neuropeptide Y, human be stored?
Store at -20°C.
What is the intended use of RP10492?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.