Peptide Medix product catalog

Research Peptides · Cat. RP10492

Neuropeptide Y, human

Supplied as 0.5 mg per unit. Purity > 95%. Molecular weight 4271.68. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog numberRP10492
Product typeResearch Peptides
Peptide familyNeuropeptide Y (NPY)
SpeciesHuman
Unit size0.5 mg
Molecular weight4271.68 Da
Purity> 95%
AppearanceLyophilized
Cas No90880-35-6
SynonymsNPY
C TerminalAmidation
Molecular FormulaC189H285N55O57S1
Source categoriesCardiovascular, Cell Signaling, Neuroscience
Research topicsCardiovascular Research, Neuropeptides & Neuroscience
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Storage & handling

Store at -20°C.

Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.

Frequently asked

What is Neuropeptide Y, human?
Neuropeptide Y, human is a research peptide listed under catalog number RP10492 in the Neuropeptide Y (NPY) family, human sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP10492?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should Neuropeptide Y, human be stored?
Store at -20°C.
What is the intended use of RP10492?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.