Peptide Medix product catalog

Research Peptides · Cat. 037-76

MP31 / Micropeptide-31 (Human)

Supplied as 100 µg per unit. Purity ≥95%. Molecular weight 3335.93. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog number037-76
Product typeResearch Peptides
Peptide familyOther Research Peptides
SpeciesHuman
Unit size100 µg
Molecular weight3335.93 Da
Purity≥95%
ValidationExhibits correct molecular weight
AppearanceWhite powder
ContentsEach vial contains 100 μg of NET peptide.
SolubilitySoluble in water
Disulfide BridgePeptide contains free Cysteine and tends to dimerize.
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

MWRDSLCAAAGYALGAGTRLRSVLSSRKLQP

Storage & handling

Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.

Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.

Frequently asked

What is MP31 / Micropeptide-31 (Human)?
MP31 / Micropeptide-31 (Human) is a research peptide listed under catalog number 037-76 in the Other Research Peptides family, human sequence. It is supplied as 100 µg per unit for in vitro laboratory research.
What purity is listed for 037-76?
The imported catalog record lists ≥95% (exhibits correct molecular weight). Request and verify current lot-specific documentation before purchase.
How should MP31 / Micropeptide-31 (Human) be stored?
Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
What is the intended use of 037-76?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.