Research Peptides · Cat. 037-76
MP31 / Micropeptide-31 (Human)
Supplied as 100 µg per unit. Purity ≥95%. Molecular weight 3335.93. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 037-76 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Other Research Peptides |
| Species | Human |
| Unit size | 100 µg |
| Molecular weight | 3335.93 Da |
| Purity | ≥95% |
| Validation | Exhibits correct molecular weight |
| Appearance | White powder |
| Contents | Each vial contains 100 μg of NET peptide. |
| Solubility | Soluble in water |
| Disulfide Bridge | Peptide contains free Cysteine and tends to dimerize. |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
MWRDSLCAAAGYALGAGTRLRSVLSSRKLQP
Storage & handling
Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is MP31 / Micropeptide-31 (Human)?
What purity is listed for 037-76?
How should MP31 / Micropeptide-31 (Human) be stored?
What is the intended use of 037-76?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.