Labeled Peptides · Fluorescent-labeled · Cat. FG-003-12A
Leptin, recombinant (Human) – FAM Labeled
Supplied as 1 nmol per unit. Molecular weight ~ 18.5 kDa. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | FG-003-12A |
|---|---|
| Product type | Labeled Peptides · Fluorescent-labeled |
| Peptide family | Leptin |
| Species | Human |
| Unit size | 1 nmol |
| Molecular weight | ~ 18.5 kDa |
| Validation | Exhibits correct molecular weight |
| Contents | Each vial contains 1 nmol of NET labeled protein. |
| Solubility | Soluble in 50mM sodium phosphate buffer (pH 8.5) or 10% DMSO in PBS buffer (pH 7.5). |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
n-FAM-(AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTISKMDGTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC)
Storage & handling
Store at -20°C with desiccant.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Leptin, recombinant (Human) – FAM Labeled?
How should Leptin, recombinant (Human) – FAM Labeled be stored?
What is the sequence of Leptin, recombinant (Human) – FAM Labeled?
What is the intended use of FG-003-12A?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.