Research Peptides · Cat. 079-51
GPR173 (217-269) (Human, Rat, Mouse, Porcine, Canine, Bovine)
Supplied as 100 µg per unit. Molecular weight 5498.72. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 079-51 |
|---|---|
| Product type | Research Peptides |
| Peptide family | GPR Receptor Peptides (Orphan GPCRs) |
| Unit size | 100 µg |
| Molecular weight | 5498.72 Da |
| Validation | Exhibits correct molecular weight |
| Appearance | White powder |
| Contents | Each vial contains 100 µg of NET peptide. |
| Solubility | Insoluble in water. Dissolve with a small amount of DMSO or 30% acetonitrile in water. Then dilute with water or any desired buffer. |
| Research topics | Cancer Research |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
MKPVQMVPAISQNWTFHGPGATGQAAANWIAGFG RGPMPPTLLGIRQNGHAAS
Storage & handling
Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is GPR173 (217-269) (Human, Rat, Mouse, Porcine, Canine, Bovine)?
How should GPR173 (217-269) (Human, Rat, Mouse, Porcine, Canine, Bovine) be stored?
What is the intended use of 079-51?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.