Research Peptides · Cat. RP12738
Glucagon-Like Peptide (GLP) I (7-37)
Supplied as 0.5 mg per unit. Purity > 95%. Molecular weight 3355.68. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP12738 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Glucagon |
| Species | Other species |
| Unit size | 0.5 mg |
| Molecular weight | 3355.68 Da |
| Purity | > 95% |
| Appearance | Lyophilized |
| Note | Potent Insulin secretagogue. |
| Synonyms | Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide |
| Molecular Formula | C151H228N40O47 |
| Source categories | Diabetes & Obesity |
| Research topics | Diabetes & Metabolism, Obesity & Appetite |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Storage & handling
Store at -20°C. Keep tightly closed. Store in a cool dry place.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Glucagon-Like Peptide (GLP) I (7-37)?
Glucagon-Like Peptide (GLP) I (7-37) is a research peptide listed under catalog number RP12738 in the Glucagon family, other species sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP12738?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should Glucagon-Like Peptide (GLP) I (7-37) be stored?
Store at -20°C. Keep tightly closed. Store in a cool dry place.
What is the intended use of RP12738?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.