Research Peptides · Cat. 029-10
GLP-1 analogue, C-terminal penicillamine-conjugated
Supplied as 100 ug per unit. Purity ≥ 95%. Molecular weight 4192.63. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 029-10 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Glucagon-Like Peptide-1 (GLP-1) |
| Unit size | 100 ug |
| Molecular weight | 4192.63 Da |
| Purity | ≥ 95% |
| Validation | Exhibits correct molecular weight |
| Appearance | White powder |
| Contents | Each VIAL contains 100 µg NET peptide |
| Research topics | Diabetes & Metabolism |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPS(Pen)NH2
Storage & handling
Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is GLP-1 analogue, C-terminal penicillamine-conjugated?
What purity is listed for 029-10?
How should GLP-1 analogue, C-terminal penicillamine-conjugated be stored?
What is the intended use of 029-10?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.