Peptide Medix product catalog

Research Peptides · Cat. 029-10

GLP-1 analogue, C-terminal penicillamine-conjugated

Supplied as 100 ug per unit. Purity ≥ 95%. Molecular weight 4192.63. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog number029-10
Product typeResearch Peptides
Peptide familyGlucagon-Like Peptide-1 (GLP-1)
Unit size100 ug
Molecular weight4192.63 Da
Purity≥ 95%
ValidationExhibits correct molecular weight
AppearanceWhite powder
ContentsEach VIAL contains 100 µg NET peptide
Research topicsDiabetes & Metabolism
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPS(Pen)NH2

Storage & handling

Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.

Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.

Frequently asked

What is GLP-1 analogue, C-terminal penicillamine-conjugated?
GLP-1 analogue, C-terminal penicillamine-conjugated is a research peptide listed under catalog number 029-10 in the Glucagon-Like Peptide-1 (GLP-1) family. It is supplied as 100 ug per unit for in vitro laboratory research.
What purity is listed for 029-10?
The imported catalog record lists ≥ 95% (exhibits correct molecular weight). Request and verify current lot-specific documentation before purchase.
How should GLP-1 analogue, C-terminal penicillamine-conjugated be stored?
Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
What is the intended use of 029-10?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.