Peptide Medix product catalog

Labeled Peptides · Fluorescent-labeled · Cat. A-1113r

FITC Beta-Amyloid (1-40), Recombinant

Supplied as 0.5 mg per unit. Purity >95% by Mass Spec.. Molecular weight Approximately 4,330 Da to 5,108 Da. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.

Specifications

Catalog numberA-1113r
Product typeLabeled Peptides · Fluorescent-labeled
Peptide familyAmyloid-Beta (Abeta) & Amyloid Precursor Protein
SpeciesHuman
Unit size0.5 mg
Molecular weightApproximately 4,330 Da to 5,108 Da
Purity>95% by Mass Spec.
ValidationPurity: >95% by Mass Spec.
AppearanceWhite lyophilized powder
SourceRecombinant. A DNA sequence encoding the human Beta-Amyloid (1-40) sequence was expressed in E. coli and had FITC molecules attached for fluorescence.
Catalog No.A-1113r
Molecular MassApproximately 4,330 Da to 5,108 Da
Physical StateWhite lyophilized powder
Shipping Classambient
Sizes & prices0.5 mg - $612.00; 1.0 mg - $953.00
Temperature Storage-20°C
Temperature ShippingAmbient
Research topicsAlzheimer's & Neurodegeneration, Neuropeptides & Neuroscience
Intended useIn vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes

Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Storage & handling

Store at -20°C; ships ambient

Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.

Frequently asked

What is FITC Beta-Amyloid (1-40), Recombinant?
FITC Beta-Amyloid (1-40), Recombinant is a fluorescent-labeled labeled peptide listed under catalog number A-1113r in the Amyloid-Beta (Abeta) & Amyloid Precursor Protein family, human sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for A-1113r?
The imported catalog record lists >95% by Mass Spec. (purity: >95% by mass spec.). Request and verify current lot-specific documentation before purchase.
How should FITC Beta-Amyloid (1-40), Recombinant be stored?
Store at -20°C; ships ambient
What is the intended use of A-1113r?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.

This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.