Labeled Peptides · Fluorescent-labeled · Cat. A-1113r
FITC Beta-Amyloid (1-40), Recombinant
Supplied as 0.5 mg per unit. Purity >95% by Mass Spec.. Molecular weight Approximately 4,330 Da to 5,108 Da. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | A-1113r |
|---|---|
| Product type | Labeled Peptides · Fluorescent-labeled |
| Peptide family | Amyloid-Beta (Abeta) & Amyloid Precursor Protein |
| Species | Human |
| Unit size | 0.5 mg |
| Molecular weight | Approximately 4,330 Da to 5,108 Da |
| Purity | >95% by Mass Spec. |
| Validation | Purity: >95% by Mass Spec. |
| Appearance | White lyophilized powder |
| Source | Recombinant. A DNA sequence encoding the human Beta-Amyloid (1-40) sequence was expressed in E. coli and had FITC molecules attached for fluorescence. |
| Catalog No. | A-1113r |
| Molecular Mass | Approximately 4,330 Da to 5,108 Da |
| Physical State | White lyophilized powder |
| Shipping Class | ambient |
| Sizes & prices | 0.5 mg - $612.00; 1.0 mg - $953.00 |
| Temperature Storage | -20°C |
| Temperature Shipping | Ambient |
| Research topics | Alzheimer's & Neurodegeneration, Neuropeptides & Neuroscience |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage & handling
Store at -20°C; ships ambient
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is FITC Beta-Amyloid (1-40), Recombinant?
What purity is listed for A-1113r?
How should FITC Beta-Amyloid (1-40), Recombinant be stored?
What is the intended use of A-1113r?
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.