Research Peptides · Cat. RP10874
Exendin-4
Supplied as 0.5 mg per unit. Purity > 95%. Molecular weight 4186.66. Species: Other species. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP10874 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Exendins (Exendin-3, Exendin-4) |
| Species | Other species |
| Unit size | 0.5 mg |
| Molecular weight | 4186.66 Da |
| Purity | > 95% |
| Appearance | Lyophilized |
| Note | This peptide interacts interacts with exendin receptor to increase pancreatic acinar cAMP. It has no secretagogue activity and does not bind to VIP receptors. |
| Cas No | 141758-74-9 |
| Synonyms | Exendin4exenatide; Byetta |
| C Terminal | Amidation |
| Molecular Formula | C184H282N50O60S |
| Source categories | Diabetes & Obesity |
| Research topics | Diabetes & Metabolism, Obesity & Appetite |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Storage & handling
Store the peptide at -20°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Exendin-4?
Exendin-4 is a research peptide listed under catalog number RP10874 in the Exendins (Exendin-3, Exendin-4) family, other species sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP10874?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should Exendin-4 be stored?
Store the peptide at -20°C.
What is the intended use of RP10874?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.