Research Peptides · Cat. 045-28
CXCL14(1-58) (Human)
Supplied as 100µg per unit. Purity Purity ≥95%. Molecular weight 6817.09. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 045-28 |
|---|---|
| Product type | Research Peptides |
| Peptide family | CXC Chemokines (CXCL) |
| Unit size | 100µg |
| Molecular weight | 6817.09 Da |
| Purity | Purity ≥95% |
| Validation | Exhibits correct M.W. |
| Appearance | White powder |
| Contents | Each vial contains 100 µg of NET peptide. |
| Disulfide Bridge | Disulfide Bonds : Cys3-Cys29, Cys5-Cys50 |
| Research topics | Cancer Research |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQST
Storage & handling
Store in dry form at 0-5°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is CXCL14(1-58) (Human)?
CXCL14(1-58) (Human) is a research peptide listed under catalog number 045-28 in the CXC Chemokines (CXCL) family. It is supplied as 100µg per unit for in vitro laboratory research.
What purity is listed for 045-28?
The imported catalog record lists Purity ≥95% (exhibits correct m.w.). Request and verify current lot-specific documentation before purchase.
How should CXCL14(1-58) (Human) be stored?
Store in dry form at 0-5°C.
What is the intended use of 045-28?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.