Research Peptides · Cat. 051-77
ASPN mimic peptide / Asporin (155–200), prepro (Rat)
Supplied as 100µg per unit. Purity Purity ≥97 %. Molecular weight 5256.13. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | 051-77 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Other Research Peptides |
| Unit size | 100µg |
| Molecular weight | 5256.13 Da |
| Purity | Purity ≥97 % |
| Validation | Exhibits correct M.W. |
| Appearance | White powder |
| Contents | Each vial contains 100 µg of NET peptide. |
| Research topics | Cancer Research |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
NQLSEIPLNLPRSLAELRIHDNKVKKIQKDTFKGMNALHVLEMSAN
Storage & handling
Store in dry form at 0-5°C.
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is ASPN mimic peptide / Asporin (155–200), prepro (Rat)?
ASPN mimic peptide / Asporin (155–200), prepro (Rat) is a research peptide listed under catalog number 051-77 in the Other Research Peptides family. It is supplied as 100µg per unit for in vitro laboratory research.
What purity is listed for 051-77?
The imported catalog record lists Purity ≥97 % (exhibits correct m.w.). Request and verify current lot-specific documentation before purchase.
How should ASPN mimic peptide / Asporin (155–200), prepro (Rat) be stored?
Store in dry form at 0-5°C.
What is the intended use of 051-77?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.