Research Peptides · Cat. RP11288
Adrenomedullin (AM) (1-52), human
Supplied as 0.5 mg per unit. Purity > 95%. Molecular weight 6028.9. Species: Human. Technical values shown are imported catalog fields and should be confirmed against current documentation. Laboratory research use only.
Specifications
| Catalog number | RP11288 |
|---|---|
| Product type | Research Peptides |
| Peptide family | Other Research Peptides |
| Species | Human |
| Unit size | 0.5 mg |
| Molecular weight | 6028.9 Da |
| Purity | > 95% |
| Appearance | Lyophilized |
| Note | The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease. |
| Cas No | 148498-78-6 |
| C Terminal | Amidation |
| Disulfide Bridge | 16-21 |
| Molecular Formula | C264H406N80O77S3 |
| Source categories | Cardiovascular, Cell Signaling |
| Research topics | Cardiovascular Research |
| Intended use | In vitro laboratory research only — not for human or veterinary use, diagnostic or therapeutic purposes |
Sequence
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
Storage & handling
Store at -20°C. Keep tightly closed. Store in a cool dry place
Confirm handling and preparation requirements against current product documentation and the requirements of your laboratory protocol.
Frequently asked
What is Adrenomedullin (AM) (1-52), human?
Adrenomedullin (AM) (1-52), human is a research peptide listed under catalog number RP11288 in the Other Research Peptides family, human sequence. It is supplied as 0.5 mg per unit for in vitro laboratory research.
What purity is listed for RP11288?
The imported catalog record lists > 95%. Request and verify current lot-specific documentation before purchase.
How should Adrenomedullin (AM) (1-52), human be stored?
Store at -20°C. Keep tightly closed. Store in a cool dry place
What is the intended use of RP11288?
This catalog listing is for laboratory research use only. It is not represented as a drug, food, supplement, cosmetic or diagnostic product, and it is not offered for human or veterinary use.
This page reproduces an imported research-catalog record. Verify identity, specifications, documentation and suitability before purchase. The item is offered only for laboratory research and is not represented for human or veterinary use.